Claim Missing Document
Check
Articles

Found 5 Documents
Search

Makna Pariwisata Pulau Kemaro menurut Pengunjung dan Perilaku Komunikasinya Maharani, Dwi
Jurnal Kajian Komunikasi Vol 2, No 1 (2014)
Publisher : Universitas Padjadjaran

Show Abstract | Download Original | Original Source | Check in Google Scholar | Full PDF (915.375 KB) | DOI: 10.24198/jkk.v2i1.6053

Abstract

Penelitian ini memiliki tujuan untuk mengkaji dan menjelaskan bagaimana pengunjung memaknai pariwisata pulau Kemaro dan mengetahui bagaimana perilaku komunikasi pengunjung pariwisata pulau Kemaro. Metode penelitian yang digunakan adalah kualitatif, dengan pendekatan fenomenologi. Subjek penelitian terdiri dari enam orang informan yang terdiri dari 3 orang pelancong budaya dan 3 orang pelancong religi yang diambil secara purposive. Hasil dari penelitian menunjukkan, pengunjung pariwisata pulau Kemaro yang merupakan informan pada penelitian ini memberikan pemaknaan terhadap pariwisata pulau Kemaro berdasarkan pandangan subjektif. Sehingga informan dalam penelitian memberikan pemaknaan yang beragam terhadap pariwisata pulau Kemaro. Hasil penelitian menunjukkan bahwa komunikasi mewarnai semua aspek yang ingin diketahui, baik dari segi pandangan, pengalaman, dan motif pada setiap pengunjung. pengunjung memberikan pandangan terhadap pariwisata pulau Kemaro sebagai tempat bersejarah, tempat yang nyaman, dan juga tempat untuk sembahyang. pengalaman yang dirasakan pelancong selama berada di pulau Kemaro berkaitan dengan kegiatan festival budaya, perayaan 17 Agustusan, perjalanan menuju pulau Kemaro, sembahyang, sampai dengan pengalaman mengenai penyembuhan penyakit. Sedangkan motif yang dimiliki pelancong, yaitu untuk mencari ketenangan dan kesenangan, ajakan dari orang terdekat (orangtua ataupun teman), untuk melakukan kegiatan keagamaan, ketertarikan pelancong pada sejarah pariwisata pulau Kemaro, serta motif untuk berkumpul bersama anggota keluarga. perilaku komunikasi yang terjadi yaitu dalam bentuk interaksi diantara pengunjung serta pengunjung dengan pelaku wisata yang menggunakan komunikasi verbal. Kesimpulan dari penelitian tentang makna pariwisata pulau Kemaro menurut pengunjung yaitu sebagai tempat warga Tionghoa untuk sembahyang, dan salah satu tempat wisata yang memiliki nilai sejarah yang tinggi dan nyaman yang ada di kota palembang.
TEACHING READING BY USING COMBINING ECHO READING AND READERS THEATRE STRATEGY FOR ELEMENTARY SCHOOL MAHARANI, DWI; Alicia, Dona
Pendidikan Bahasa Inggris Vol 2, No 2 (2013): Jurnal Mahasiswa Bahasa Inggris Genap 2012-2013
Publisher : Pendidikan Bahasa Inggris

Show Abstract | Download Original | Original Source | Check in Google Scholar

Abstract

ABSTRAK PengajaranReadingmerupakansalahsatukomponenpentingdalambelajarbahasainggrisyang harusdiajarkanolehseorang guru kepadasiswa.SejalandenganpentingnyapengajaranReadingmaka, seorang guru haruskreatifuntukmembuatpembelajaranReadingmenjadilebihmenyenangkan.Salah satunyadenganmenerapkanstrategi yang menarikdantepat dalampembelajaranReading.Sehingga, siswatertarikdantermotivasiuntukmempelajarinya.Penulismembahas tentang bagaimana mengajarkan Reading melalui gabungan dua strategi yaitu Echo Reading dengan Readers Theatre Strategy.Echo Reading Strategy adalahstrategimembacadengancara guru mengajarkankepadasiswabagaimanacaramembacateksdenganbenardansiswamengulangnyakembali. Readers Theatre Strategyadalahstrategimembaca yang menggunakannaskah yang dimanasiswadapatmembawakaraktersebuahnaskahmenjadihidup.Dalam aplikasi dua strategi ini, lebihmengedepankankepadaaktivitassiswadalammembacateks.  
Makna Pariwisata Pulau Kemaro menurut Pengunjung dan Perilaku Komunikasinya Maharani, Dwi
Jurnal Kajian Komunikasi Vol 2, No 1 (2014): Jurnal Kajian Komunikasi (JKK) Vol.2, No.1, Juni 2014
Publisher : Jurnal Kajian Komunikasi

Show Abstract | Download Original | Original Source | Check in Google Scholar | Full PDF (0.262 KB)

Abstract

Penelitian ini memiliki tujuan untuk mengkaji dan menjelaskan bagaimana pengunjung memaknai pariwisatapulau Kemaro dan mengetahui bagaimana perilaku komunikasi pengunjung pariwisata pulau Kemaro. Metodepenelitian yang digunakan adalah kualitatif, dengan pendekatan fenomenologi. Subjek penelitian terdiri dari enamorang informan yang terdiri dari 3 orang pelancong budaya dan 3 orang pelancong religi yang diambil secarapurposive. Hasil dari penelitian menunjukkan, pengunjung pariwisata pulau Kemaro yang merupakan informanpada penelitian ini memberikan pemaknaan terhadap pariwisata pulau Kemaro berdasarkan pandangan subjektif.Sehingga informan dalam penelitian memberikan pemaknaan yang beragam terhadap Pariwisata Pulau Kemaro.Hasil penelitian menunjukkan bahwa komunikasi mewarnai semua aspek yang ingin diketahui, baik dari segi pandangan,pengalaman, dan motif pada setiap pengunjung. Pengunjung memberikan pandangan terhadap PariwisataPulau Kemaro sebagai tempat bersejarah, tempat yang nyaman, dan juga tempat untuk sembahyang. Pengalamanyang dirasakan pelancong selama berada di pulau Kemaro berkaitan dengan kegiatan festival budaya, perayaan 17Agustusan, perjalanan menuju Pulau Kemaro, sembahyang, sampai dengan pengalaman mengenai penyembuhanpenyakit. Sedangkan motif yang dimiliki pelancong, yaitu untuk mencari ketenangan dan kesenangan, ajakan dariorang terdekat (orangtua ataupun teman), untuk melakukan kegiatan keagamaan, ketertarikan pelancong padasejarah pariwisata pulau Kemaro, serta motif untuk berkumpul bersama anggota keluarga. Perilaku komunikasiyang terjadi yaitu dalam bentuk interaksi diantara pengunjung serta pengunjung dengan pelaku wisata yangmenggunakan komunikasi verbal. Kesimpulan dari penelitian tentang makna pariwisata pulau Kemaro menurutpengunjung yaitu sebagai tempat warga Tionghoa untuk sembahyang, dan salah satu tempat wisata yang memilikinilai sejarah yang tinggi dan nyaman yang ada di kota Palembang.Kata-kata kunci: Makna pariwisata, perilaku komunikasi, Pulau Kemaro, Palembang
APLIKASI PEMESANAN TIKET KOLAM RENANG MUSI PATRA SECARA ONLINE Maharani, Dwi; Solikin, Imam
SEMHAVOK Vol 2 No 2 (2020): Juli - Desember 2020
Publisher : Fakultas Vokasi

Show Abstract | Download Original | Original Source | Check in Google Scholar

Abstract

Proses pemesanan tiket masuk pada Kolam Renang Musi Patra dilakukan dengan cara, yaitu pengunjung harus mengantri ke tempat penjualan tiket untuk memesan tiket. Hal ini menjadi ketidaknyamanan pengunjung terutama dalam segi waktu. Oleh karena itu peneliti merancang sebuah aplikasi web pemesanan tiket online berbasiskan teknologi web dengan menggunakan bahasa pemograman PHP dan Database MySQL. Dengan sistem ini, Kolam Renang Musi Patra dapat menjual tiket kepada pengunjung tanpa harus mengantri. Pengunjung juga dapat melakukan pemesanan tiket masuk Kolam Renang Musi patra dengan melalui media internet.
STRATEGI RRI (RADIO REPUBLIK INDONESIA) PALEMBANG MEMPERTAHANKAN MINAT PENDENGAR DI ERA DIGITALISASI PENYIARAN Maharani, Dwi
Publikasi Penelitian Terapan dan Kebijakan Vol 4 No 1 (2021): Publikasi Penelitian Terapan dan Kebijakan
Publisher : Badan Penelitian dan Pengembangan Daerah Provinsi Sumatera Selatan

Show Abstract | Download Original | Original Source | Check in Google Scholar | DOI: 10.46774/pptk.v4i1.334

Abstract

Tujuan penelitian ini untuk mengetahui dan mendeskripsikan Strategi Defisi Pemberitaan RRI untuk Mempertahankan Minat Pendengar di Era Digitalisasi Penyiaran. Pendekatan penelitian ini dengan menggunakan metode deskriptif kualitatif. Objek pada penelitian ini membahas strategi pemberitan RRI terhadap Konten, Target Audience, Jam Siar, dan SDM. Subjek pada penelitian ini adalah Kepala Pusat Pemberitaan RRI, Reporter Pro 3 RRI, Penyiar Pro 3 RRI, dan Kontributor Pro 3 RRI. Teknik pengumpulan data melalui observasi, wawancara, studi kepustakaan, dan dokumentasi. Berdasarkan penelitian diperoleh strategi yang dilakukan RRI untuk mempertahankan minat pendengar dengan cara (1) membuat program yang melibatkan pendengar, yang mana pendengar dapat mengirimkan dan memberikan informasi kepada masyarakat atau disebut citizen journalism melalui RRI 30 Detik. (2) RRI melakukan siaran selama 24 jam dalam sehari. (3) RRI bekerja sama dengan Pusdiklat, membuat program reporter dan presenter unggulan serta mengadakan diskusi rutin dengan presenter dan reporter di lapangan. Kegiatan ini bertujuan untuk meningkat kulaitas presenter dan reporter, yang mana tugas mereka langsung berhubungan dengan pendengar.Selain itu, dalam hal teknologi untuk memasuki era digitalisasi. (4) RRI menciptakan tiga aplikasi berbasis sistem android dan iOS yang dapat diunduh google store dan Appstore antara lain RRI Play, Be Young, dan RRI 30 Detik.