Articles
PERANCANGAN MEDIA PEMBELAJARAN E-LEARNING PADA SMA N 8 KOTA JAMBI
AVENI NATALIA PANJAITAN;
ALI SADIKIN;
BENI IRAWAN
Jurnal Processor Vol 13 No 2 (2018): Processor
Publisher : LPPM STIKOM Dinamika Bangsa
Show Abstract
|
Download Original
|
Original Source
|
Check in Google Scholar
|
Full PDF (623.722 KB)
SMA N 8 Kota Jambi is one of the upper secondary education institutions. The learning process at SMA N 8 Kota Jambi experiences problems where teachers and students must meet face to face in the teaching and learning process and if the teacher is unable to attend the students do not get the lesson matter and there is limited time in doing the learning or doing the task and repetition in one meeting. To overcome these problems researchers do the design of e-learning learning media built using PHP and MySQL DBMS. The methods used in this research are from problem identification, literature study, data collection, problem analysis, system development and report generation. This e-learning application is expected to facilitate the teacher in distributing the subject matter, the tasks or repetition questions to the students and check the results of the exercises that students do, as well as a means of distance learning because the application is accessed online.
Perancangan Aplikasi Pengenalan Alat Musik Tradisional Nusantara Berbasis Android
Wahyuzi Andriansyah;
Ali Sadikin
Jurnal Processor Vol 12 No 2 (2017): Processor
Publisher : LPPM STIKOM Dinamika Bangsa
Show Abstract
|
Download Original
|
Original Source
|
Check in Google Scholar
|
Full PDF (583.214 KB)
Traditional music is a music that develop across the archipelago and is a here dictary practice which is still on the run in society. The music is scattered almost all over and every region have different characteristics. Musical archipelago is born, grows, and develops throughout the archipelago. But the public interest to learn and know traditional musical instruments have begun to decrease because the traditional musical instruments are considered ancient and out of date so they are reluctant to learn it. One way for people to know as well as learning the traditional musical instrument is by creating an introduction application of traditional musical instruments archipelago based android instrument made in 3D to make it interesting interest of the community to learn it. System modeling On the construction of this application use UML (Unified Modelling Language) with tools activity diagram, use case And developed using the model waterfall Which is run on android operating system. This app is expected Can be an appropriate tool So that people want to Learn the traditional musical instruments archipelago.
ANALISIS DAN PERANCANGAN APLIKASI PENJUALAN PADA GALLERY BATIK JAMBI DESMIATI
Andeh Lukito;
Sharipuddin Sharipuddin;
Ali Sadikin
Jurnal Processor Vol 10 No 2 (2015): Processor
Publisher : LPPM STIKOM Dinamika Bangsa
Show Abstract
|
Download Original
|
Original Source
|
Check in Google Scholar
|
Full PDF (485.19 KB)
Saat ini sistem pengolahan data penjualan pada Gallery Batik Jambi Desmiati belum dikelola secara terkomputerisasi Seperti, Data barang, kategori barang, data satuan barang, data transaksi penjualan. masih dibuat atau di kelola secara manual dalam bentuk laporan yang masih menggunakan metode pencatatan yang di masukan ke dalam buku besar, sedangkan transaksi antara pembeli dan penjual dilakukan dengan mencatat nama barang serta harga beli yang dimaksukan ke dalam nota pembayaran. Sehingga, dalam masalah ini dibutuhkan suatu solusi untuk memecahkan masalah tersebut yaitu dengan membangun Perancangan Aplikasi Penjualan yang dapat mengelola data penjualan tersebut secara terkomputerisasi yang nantinya akan tersimpan dalam suatu database. Untuk merancang sistem ini diperlukan beberapa metode penelitian, diantaranya metode pengumpulan data menggunakan penelitian lapangan serta metode pengembangan sistem menggunakan waterfall. Analisis Dan Perancangan Aplikasi Penjualan Pada Gallery Batik Jambi Desmiati dibangun secara keseluruhan menggunakan bahasa pemoprograman Vb, DBMS Mysql. Dengan Dirancangnya Sistem Aplikasi Penjualan Pada Gallery Batik Jambi Desmiati ini dapat mempermudah pihak pemilik gallerry untuk mengelola data penjualan
ANALISIS PENGARUH BETA, UKURAN PERUSAHAAN, DAN RASIO BOOK TO MARKET TERHADAP RETURN SAHAM (STUDI KASUS PADA PERUSAHAAN SEKTOR CONSUMER GOODS PERIODE 2008 – 2011)
Ali Sadikin
Al-KALAM : JURNAL KOMUNIKASI, BISNIS DAN MANAJEMEN Vol 2, No 1 (2015)
Publisher : Universitas Islam Kalimantan Muhammad Arsyad Al Banjari
Show Abstract
|
Download Original
|
Original Source
|
Check in Google Scholar
|
Full PDF (458.503 KB)
|
DOI: 10.31602/al-kalam.v2i1.280
Investment is rational action did by humans to increase their wealth in the future, with sacrifice money and other economic resources in investing there are some things that should be considered by investors one of which is the return and risk. In general, investors will always consider the trade off between return that will be earned in investing and the risks to be faced in making such investments. The object of this study was the Consumer Goods sector Manufacturing industries listed in the Indonesia Stock Exchange for 4 years, from 2008 to 2011. The method of selecting samples in this research is purposive judgment sampling method. The F-test was 0,000 which is smaller than the degree of error is equal to 0.05 or 5% thus Beta, company size, and the ratio of book to market simultaneously - significant effect in predicting Return Consumer Goods shares in the company. T test results showed the Beta coefficient of 0.023 with a significance value of 0.004. This means Beta significant positive effect due to the significance value of 0.004 is smaller than the required significance level of 5%. Company size coefficient of 2.349 and 0.915 significance value. This means that the size of the company does not have a significant effect because the significance value of 0.915 is much larger than the required significance level of 5%. Coefficient of book to market ratios of -0.015 with a significance value of 0.001. This means that the ratio of book to market significant negative effect because the significance value 0.001 is much smaller than the required significance level of 5%. Key words : Beta, Firm size, Market to book ratio, and Stock Retuns.
Analisis Pengaruh Corporate Social Responsibility Terhadap Return Saham Dengan ROE Sebagai Variabel Moderating Pada Indeks LQ-45.
Nofimbi Fitriani;
Ali Sadikin;
Amalia Wahyuni
Al-KALAM : JURNAL KOMUNIKASI, BISNIS DAN MANAJEMEN Vol 8, No 1 (2021): Januari : Al Kalam Jurnal Komunikasi, Bisnis dan Manajemen
Publisher : Universitas Islam Kalimantan Muhammad Arsyad Al Banjari
Show Abstract
|
Download Original
|
Original Source
|
Check in Google Scholar
|
DOI: 10.31602/al-kalam.v8i1.4160
This research type is a causality with the aim of analyzing the effect of Corporate Social Responsibility on stock returns with profitability as a moderating variable on the LQ-45 Stock Index during the 2013-2017 period. The research population is all companies listed in the LQ-45 Index on the Indonesia Stock Exchange during 2013-2017. The sampling using purposive sampling method with a total sample of 23 companies. Data of this research is quantitative type with data analysis techniques consisting of descriptive analysis, testing classic assumptions, moderating regression analysis, and testing hypotheses. The results showed that there was a significant positive effect on testing the effect of Corporate Social Responsibility on Stock Returns. While the high or low profitability (Return on Equity) is considered unable to moderate the influence of Corporate Social Responsibility on Stock Returns because of the large expenditure incurred for Corporate Social Responsibility can have a negative impact on business operations that will reduce the level of profitability obtained by the investor.
ISU-ISU STRATEGIS PEMBANGUNAN PARTISIPATIF MELALUI MUSREMBANG KECAMATAN MUARA BENGKAL KABUPATEN KUTAI TIMUR
Ali Sadikin
ADMINISTRASI PUBLIK Vol 1, No 1 (2019)
Publisher : ADMINISTRASI PUBLIK
Show Abstract
|
Download Original
|
Original Source
|
Check in Google Scholar
Penelitian ini bertujuan ini untuk mengetahui Isu-Isu Strategis Pembangunan Partisipatif Melalui Musrembang Kecamatan Muara Bengkal Kabupaten Kutai Timur. Metode penelitian yang digunakan yaitu pendekatan kualitatif dengan tipe penelitian fenomenologi dengan melakukan pengumpulan yang diperoleh melalui teknik observasi, wawancara, dan dokumentasi. Proses analisis data meliputi reduksi data, penyajian data, dan penarikan kesimpulan. Hasil penelitian menunjukkan bahwa secara actual kondisi masyarakat yang memerlukan pembangunan fisik untuk diproritaskan dalam pembangunan desa dan kelurahan di Kecamatan Muara Bengkal. Dari sisi urgensi, terdapat prioritas dalam pembangunan di Kecamatan Muara Bengkal yang dinilai memiliki urgensi terutama yang terkait dengan sarana umum seperti sarana kesehatan, jaringan air, listrik, jalan, jembatan, dan balai pertemuan memilik iurgensi dalam pembangunan desa. Selanjutnyadariindikatorrelevansimenunjukkanisupembangunan yang diaspirasikanmemilikikesesuaiandenganprioritaspembangunandesa di KecamatanMuaraBengkal. Kemudiandampakpositif yang dapatdicermatiyaitumasyarakatdapatdilibatkandalam proses perencanaanpembangunan di Desasehinggaterbangunkepercayaanantarapemerintah dan masyarakatnamuntidakdapatdipungkiribahwaadaketidakpuasansejumlahpihak. Pada indikatorkesesuaianvisimisimenunjukkanketerlibatansejumlah OPD atau SKPD merupakanupayapemerintahdaerahdalammenyelaraskanvisimisikabupatendalampenyelenggaraanMusrembang di KecamatanMuaraBengkal SKPD yang terlibatmengontrolrealisasidariperencanaanpembangunan di KecamatanMuaraBengkal. Padaindikatorinklusimenunjukkanisustrategis yang dibahasbelummamputerserapsecara optimal kendalanyaadalahpembahasantidakfokus dan selaludibatasiwaktukecenderungan yang munculadalahlebihkepadakuantitasdaripadakualitashasilpembahasanmasihdibutuhkanwaktuuntukmemperdalamisustrategis yang dipalingdibutuhkanmasyarakat. Selanjutnyahasilpenelitian pada indikatorsensitivitasmenunjukkanisusensitivitas yang munculadalah pada saatmusyawarahadadugaanaspirasihanyamewadahikepentingankelompok dan juga terkaittanah yang dijadikantempatpembangunansaranaumum.
PENEGAKAN HUKUM TERHADAP TINDAK PIDANA KEHUTANAN PASCA BERLAKUNYA PERDIRJEN KSDAE TENTANG KEMITRAAN KONSERVASI
Ali Sadikin
Bina Hukum Lingkungan Vol 5, No 2 (2021): Bina Hukum Lingkungan
Publisher : Pembina Hukum Lingkungan Indonesia (PHLI)
Show Abstract
|
Download Original
|
Original Source
|
Check in Google Scholar
|
DOI: 10.24970/bhl.v5i2.159
ABSTRAKKawasan hutan konservasi diatur dalam UU No. 5 Tahun 1990 tentang KSDAE. Berlakunya Perdirjen KSDAE No. P.6/KSDAE/SET/Kum.1/6/2018 tentang petunjuk teknis kemitraan konservasi memunculkan kesenjangan normatif dalam hukum positif dengan memberikan legitimasi kepada masyarakat sekitar kawasan hutan untuk melakukan kegiatan diluar amanat UU.No.5 Tahun 1990 tentang KSDAE. Permasalahan penelitian ini menekankan pada: Bagaimana pengaturan hukum tindak pidana kehutanan dalam kawasan konservasi? Bagaimana penegakan hukum tindak pidana kehutanan dalam kawasan hutan konservasi pasca berlakunya perdirjen ksdae? Bagaimana hambatan dan solusi dalam penegakan hukum tindak pidana kehutanan dalam kawasan konservasi pasca berlakunya perdirjen KSDAE? Metode Penelitian ini menggunakan penelitian hukum normatif yang bersifat kualitatif. Rekomendasi perlu penguatan konsep konservasi dalam Perdirjen KSDAE sehingga tidak mengaburkan perbuatan pidana kehutanan. Tujuan penelitian ini untuk mengetahui sejauh mana penegakan hukum tindak pidana kehutanan di kawasan konservasi pasca berlakunya Perdirjen KSDAE. Disimpulkan bahwa berlakunya perdirjen ksdae tentang petunjuk teknis kemitraan konservasi di kawasan hutan konservasi telah melakukan sifat melawan hukum formil. Kata kunci: kawasan konservasi; kemitraan; kesenjangan normatif; Perdirjen KSDAE.ABSTRACTThe conservation areas are regulated with the Act No. 5 in 1990 About KSDAE. It is amended about the technique instructions of conservation partnership appeared the norm discrepancy on the level of positive law by preventing the legitimacy to the society surround the forest areas to execute the activities beyond the Act No. 5 in 1990 About KSDAE. This observation focused on how to hold up the forest crime in the conservation areas? How is the legal up holding of forestry crime in the conservation areas after being available? How are the blocking and solution in upholding the forestry crime in the conservation areas after being available? This observation method is used the legal normative observation with qualitative. Recommendation is to be strengthened the concept of conservation on dirjen of regulation so it is no blurred the acts of forestry crime. This aim of observation to recognize how far the legal upholding of feresty crime in conservation areas after being available the regulation of dirjen. It Concluded that being available the ksdae regulation about the technical partnership conservation in the conservation area has contradicted against the nature of legal formil.Keywords: the conservation areas; partnership; the legal norm of discrepancy; the regulation of KSDAE.
PENEGAKAN HUKUM TERHADAP TINDAK PIDANA KEHUTANAN PASCA BERLAKUNYA PERDIRJEN KSDAE TENTANG KEMITRAAN KONSERVASI
Ali Sadikin
Bina Hukum Lingkungan Vol 5, No 2 (2021): Bina Hukum Lingkungan
Publisher : Pembina Hukum Lingkungan Indonesia (PHLI)
Show Abstract
|
Download Original
|
Original Source
|
Check in Google Scholar
|
Full PDF (260.132 KB)
|
DOI: 10.24970/bhl.v5i2.159
ABSTRAKKawasan hutan konservasi diatur dalam UU No. 5 Tahun 1990 tentang KSDAE. Berlakunya Perdirjen KSDAE No. P.6/KSDAE/SET/Kum.1/6/2018 tentang petunjuk teknis kemitraan konservasi memunculkan kesenjangan normatif dalam hukum positif dengan memberikan legitimasi kepada masyarakat sekitar kawasan hutan untuk melakukan kegiatan diluar amanat UU.No.5 Tahun 1990 tentang KSDAE. Permasalahan penelitian ini menekankan pada: Bagaimana pengaturan hukum tindak pidana kehutanan dalam kawasan konservasi? Bagaimana penegakan hukum tindak pidana kehutanan dalam kawasan hutan konservasi pasca berlakunya perdirjen ksdae? Bagaimana hambatan dan solusi dalam penegakan hukum tindak pidana kehutanan dalam kawasan konservasi pasca berlakunya perdirjen KSDAE? Metode Penelitian ini menggunakan penelitian hukum normatif yang bersifat kualitatif. Rekomendasi perlu penguatan konsep konservasi dalam Perdirjen KSDAE sehingga tidak mengaburkan perbuatan pidana kehutanan. Tujuan penelitian ini untuk mengetahui sejauh mana penegakan hukum tindak pidana kehutanan di kawasan konservasi pasca berlakunya Perdirjen KSDAE. Disimpulkan bahwa berlakunya perdirjen ksdae tentang petunjuk teknis kemitraan konservasi di kawasan hutan konservasi telah melakukan sifat melawan hukum formil. Kata kunci: kawasan konservasi; kemitraan; kesenjangan normatif; Perdirjen KSDAE.ABSTRACTThe conservation areas are regulated with the Act No. 5 in 1990 About KSDAE. It is amended about the technique instructions of conservation partnership appeared the norm discrepancy on the level of positive law by preventing the legitimacy to the society surround the forest areas to execute the activities beyond the Act No. 5 in 1990 About KSDAE. This observation focused on how to hold up the forest crime in the conservation areas? How is the legal up holding of forestry crime in the conservation areas after being available? How are the blocking and solution in upholding the forestry crime in the conservation areas after being available? This observation method is used the legal normative observation with qualitative. Recommendation is to be strengthened the concept of conservation on dirjen of regulation so it is no blurred the acts of forestry crime. This aim of observation to recognize how far the legal upholding of feresty crime in conservation areas after being available the regulation of dirjen. It Concluded that being available the ksdae regulation about the technical partnership conservation in the conservation area has contradicted against the nature of legal formil.Keywords: the conservation areas; partnership; the legal norm of discrepancy; the regulation of KSDAE.
ANALISIS DAN PERANCANGAN APLIKASI PENJUALAN PADA GALLERY BATIK JAMBI DESMIATI
Andeh Lukito;
Sharipuddin Sharipuddin;
Ali Sadikin
Jurnal PROCESSOR Vol 10 No 2 (2015): Processor
Publisher : LPPM Universitas Dinamika Bangsa
Show Abstract
|
Download Original
|
Original Source
|
Check in Google Scholar
Saat ini sistem pengolahan data penjualan pada Gallery Batik Jambi Desmiati belum dikelola secara terkomputerisasi Seperti, Data barang, kategori barang, data satuan barang, data transaksi penjualan. masih dibuat atau di kelola secara manual dalam bentuk laporan yang masih menggunakan metode pencatatan yang di masukan ke dalam buku besar, sedangkan transaksi antara pembeli dan penjual dilakukan dengan mencatat nama barang serta harga beli yang dimaksukan ke dalam nota pembayaran. Sehingga, dalam masalah ini dibutuhkan suatu solusi untuk memecahkan masalah tersebut yaitu dengan membangun Perancangan Aplikasi Penjualan yang dapat mengelola data penjualan tersebut secara terkomputerisasi yang nantinya akan tersimpan dalam suatu database. Untuk merancang sistem ini diperlukan beberapa metode penelitian, diantaranya metode pengumpulan data menggunakan penelitian lapangan serta metode pengembangan sistem menggunakan waterfall. Analisis Dan Perancangan Aplikasi Penjualan Pada Gallery Batik Jambi Desmiati dibangun secara keseluruhan menggunakan bahasa pemoprograman Vb, DBMS Mysql. Dengan Dirancangnya Sistem Aplikasi Penjualan Pada Gallery Batik Jambi Desmiati ini dapat mempermudah pihak pemilik gallerry untuk mengelola data penjualan
PEMBANGUNAN MODEL DATA UNTUK SISFO AKADEMIK STIKOM DINAMIKA BANGSA JAMBI
Ali Sadikin
Jurnal PROCESSOR Vol 12 No 1 (2017): Jurnal Processor
Publisher : LPPM Universitas Dinamika Bangsa
Show Abstract
|
Download Original
|
Original Source
|
Check in Google Scholar
SISFO Akademik STIKOM Dinamika Bangsa Jambi was builded with supported by not good database design. It’s caused by the information need was responsed by building database incidentially without data model which can be used as a guide. The results are as like the lost of historical data, hard to make important information and difficult to integrating it with another information system. To fix those problems then needed to do a study to build a data model which can describe the academy domain activities which result of the analysis of it’s business process. In the building of the data model for SISFO Akademik STIKOM Dinamika Bangsa Jambi is parted in first two steps which are the conceptual and the logical step. For the data model result representation, ER diagram is used. So that with the data model, SISFO Akademik STIKOM Dinamika Bangsa Jambi could supported by a better integrated and better integrity database.