Article Per Year (5 Year)
p-Index From 2019 - 2024
2.502
P-Index
This Author published in this journals
All Journal Jurnal Penelitian Saintek Inersia : Jurnal Teknik Sipil dan Arsitektur Bioma : Berkala Ilmiah Biologi Prosiding Seminar Biologi Jurnal Akademika Biologi Journal of Biomedicine and Translational Research Prosiding KPSDA Tesa Arsitektur JURNAL BIOLOGI INDONESIA BIOMA Majalah Ilmiah Biologi BIOSFERA: A Scientific Journal Biosaintifika: Journal of Biology & Biology Education Berkala Bioteknologi NICHE Journal of Tropical Biology Jurnal PROTEKSI (Proyeksi Teknik Sipil) Proceeding Biology Education Conference Berkala Penelitian Hayati Makara Journal of Science JURNAL BIOLOGI PAPUA
Wijanarka Wijanarka
Departement Of Biology, Faculty Of Science And Mathematics, The University Of Diponegoro, Semarang Indonesia
Agriculture, Biological Sciences & Forestry Biochemistry, Genetics & Molecular Biology Civil Engineering, Building, Construction & Architecture Decision Sciences, Operations Research & Management Earth & Planetary Sciences Education Environmental Science Immunology & microbiology Materials Science & Nanotechnology Medicine & Pharmacology Public Health

Published : 39 Documents Claim Missing Document
Claim Missing Document
Check
Articles

Found 1 Documents
Search
Journal : Journal of Biomedicine and Translational Research

 1 
In Silico Analysis Prediction of B-Cell Epitope as a Vaccine Candidate for SARS-CoV-2 B.1.617.2 (Delta) Variant Mauritz Nicolaas Wattimena; Wijanarka Wijanarka
Journal of Biomedicine and Translational Research Vol 8, No 1 (2022): April 2022
Publisher : Faculty of Medicine, Universitas Diponegoro

Show Abstract | Download Original | Original Source | Check in Google Scholar | DOI: 10.14710/jbtr.v1i1.13113

Abstract

Background: The COVID-19 pandemic by SARS-CoV-2 has caused many losses. One way to prevent the spread of this virus is to get vaccinated. However, the latest SARS-CoV-2 variants, including variant B.1.617.2 (Delta) are doubtful to be inhibited by existing vaccines because of mutations. Therefore, we need a new vaccine candidate that is effective against this SARS-CoV-2 variant. Through an immunoinformatics approach with various software and analysis websites, vaccine candidates can be predicted in a short time.Objective: Identity, analyze, obtain, and confirm the selected B-cell epitope sequence that can be used as a vaccine candidate for the SARS-CoV-2 B.1.617.2 (Delta) variant.Methods: This research was conducted by isolating the amino acid peptide sequence in the SARS-CoV-2 B.1.617.2 (Delta) variant protein spike from the Protein Data Bank which is suspected to be an immunogenic epitope and can be used as a vaccine candidate. A Series of tests were carried out such as antigenicity, toxicity, allergenicity, and BLAST® protein to ensure that this vaccine candidate is safe for later application into the human body. The next stage is a conservation analysis to see its potential by comparing it with the SARS-CoV-2 Delta (B.1.617.2) variant spike protein sequence in Indonesia. The study ended by mapping amino acid peptides to the SARS-CoV-2 Delta (B.1.617.2) variant spike protein using the Biovia Discovery Studio Visualizer v21.1.0.20298 2020 software to ensure that the selected sequences were epitope.Results: From the five amino acid peptides that have been isolated, the FTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFT epitope sequence has good results than the others. It is probable an antigen, non-toxic, non-allergen, and non-homolog to the human body protein.Conclusion: Based on this in silico study, it was found that the FTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFT epitope sequence was the best to be used as a vaccine candidate of SARS-CoV-2 B.1.617.2 (Delta) variant.Keywords: SARS-CoV-2 B.1.617.2 (Delta) variant, B-cell epitope, vaccine, in silico, immunoinformatics.
Co-Authors Agung Suprihadi Anggistina Wulansari Ari Indrianto Ari Indrianto Ari Indrianto Ari Indrianto Arina Tri Lunggani Budi Raharja Dewi Ayu Maryati Endang Kusdiyantini Endang Kusdiyantini Endang Kusdiyantini Endang Sutariningsih Endang Sutariningsih Endang Sutariningsih Soetarto Endang Sutariningsih Soetarto ENDANG SUTARININGSIH SOETARTO Fahrurrozi Fahrurrozi Fathika Fitrania Fitri Ulfana Risky Galih Pertiwi Akbar Hermin Hermin Ihdina Isfara Suteja Ika Anggraini Indra Bakti Sangalang Inggrit Amedia, Inggrit K Endang Kumala Dewi Kumala Dewi Kumala Dewi Kumala Dewi Lailatul Mubarokhah Laily Kurniawati Ledy Ginting Lynda - Sutrisna Maria Sarah Fadillah Maulida Aglinia Maulida Aqlinia Mauritz Nicolaas Wattimena MG Isworo Rukmi Moch Ali Utomo Mochamad Hadi NANIK RAHMANI Nomeritae Nomeritae Noor Hamidah Pragati Wira Anggini Putri S. Noor Rahmah Qisti Nadina Rahmasari, Dianti Rahmasari, Dianti Rahmawati Dewi Rejeki Siti Ferniah Romario Dion Rudi Waluyo salamah salamah Sarjana Parman Sarsa A.N Siti Maisaroh Sri Pujiyanto Susiana Purwantisari T. A. Lestari Tia Erfianti YOPI YOPI