Iwan junaedi
Fakultas Matematika dan Ilmu Pengetahuan Alam, Universitas Negeri Semarang

Published : 59 Documents Claim Missing Document
Claim Missing Document
Check
Articles

PENINGKATAN AKTIVITAS DAN HASIL BELAJAR MELALUI PBL PADA SISWA KELAS X SMA Puji Astuti, Retno; Junaedi, Iwan
Lembaran Ilmu Kependidikan Vol 42, No 2 (2013)
Publisher : Universitas Negeri Semarang

Show Abstract | Download Original | Original Source | Check in Google Scholar

Abstract

Penelitian ini bertujuan untuk meningkatkan aktivitas dan hasil belajar biologi materi pencemaran pada siswa kelas X .Setting penelitian ini adalah di SMA Negeri 4 Pekalongan kelas X6 dengan jumlah 30 siswa  dari Februari sampai Juli 2013.  Data penelitian yang dikumpulkan berupa informasi aktivitas dan hasil belajar siswa dalam pelajaran biologi materi pencemaran. Alat pengumpul data berupa : lembar observasi dan daftar nilai siswa. Teknik analisis data yang digunakan adalah teknik deskriptif komparatif. Prosedur penelitian dilakukan dengan prosedur PTK menggunakan  dua siklus yaitu siklus I dan siklus II. Hasil  Penelitian ini adalah: pada siklus I, siswa yang tuntas adalah 19 dari 30 siswa atau 63,3% dan siswa yang tidak tuntas adalah 11 dari 30 siswa atau 26,7 %. Hasil pada siklus II  adalah: siswa yang tuntas 25 dari 30 siswa atau 83,3%. Terdapat peningkatan 20% dari siklus I Sedangkan keaktifan siswa pada siklus I adalah 20 siswa dari 30 siswa atau 67,7%. Pada siklus II keaktifan siswa  mengalami peningkatan menjadi 28 siswa dari 30 siswa atau 90%. Dengan hasil penelitian  dari siklus I ke siklus II, dapat disimpulkan pembelajaran dengan PBL dapat meningkatkan aktivitas dan hasil belajar siswa pada materi pencemaran siswa kelas X6 SMA Negeri 4 Pekalongan Tahan 2012/2013.   This study aims to improve the learning outcomes of the activity and biological material in class X pollution. Setting this research is in SMA Negeri 4 Pekalongan X6 class by the number of 30 students from February to July 2013. The research data were collected in the form of information activities and student learning outcomes in a biology lesson material contamination. A data collection tool: observation sheets and a list of students grades. The data analysis technique used is a comparative descriptive technique. Research procedures performed by PTK procedure using two cycles of the cycle I and cycle II. The results of this study are: in the first cycle, students who pass is 19 of 30 or 63.3% of students and students who did not complete is 11 out of 30 students or 26.7%. Results of the second cycle are: students who completed 25 of 30 students or 83.3%. There is a 20% increase from the first cycle while active students in the first cycle were 20 students from 30 students or 67.7%. In the second cycle active students increased from 30 students to 28 students or 90%. With results from the first cycle to the second cycle, it can be concluded with PBL can enhance learning activities and learning outcomes of students at grade material contamination X6 SMAN 4 Pekalongan year 2012/2013.
Tipe Kesalahan Mahasiswa dalam Menyelesaikan Soal-Soal Geometri Analitik Berdasar Newman’s Error Analysis (NEA) Junaedi, Iwan
Kreano, Jurnal Matematika Kreatif-Inovatif Vol 3, No 2 (2012): Kreano, Jurnal Matematika Kreatif-Inovatif
Publisher : Jurusan Matematika, Fakultas Matematika dan Ilmu Pengetahuan Alam, Universitas Negeri Sema

Show Abstract | Download Original | Original Source | Check in Google Scholar | DOI: 10.15294/kreano.v3i2.2872

Abstract

Kemampuan mahasiswa dalam menyelesaikan soal-soal matematika langsung atau tidak langsung dipengaruhi oleh pola penyelesaian soal pada saat mahasiswa duduk di bangku sekolah. Hasil pengamatan menujukkan bahwa masih terdapat mahasiswa yang tidak malakukan tindakan apapun terhadap soal pembuktian, meskipun hanya  pada tahapan understand the problem. NEA merupakan kerangka kerja dengan  prosedur diagnostik sederhana, yang meliputi (1) decoding, (2) comprehension, (3) transformation, (4) process skill, dan (5) encoding. Metode diagnostik  yang dikembangkan Newman ini digunakan  untuk mengidentifikasi kategori  kesalahan terhadap jawaban dari sebuah tes uraian.  Sehingga bagaimana deskripsi jenis kesalahan mahasiswa dalam  menyelesaikan soal-soal pembuktian pada mata kuliah Geometri Analitik berdasarkan Newman’s Error Analysis (NEA), dan apa saja penyebab kesalahan mahasiswa dalam menyelesaikan soal-soal pembuktian, khususnya pada mata kuliah  Geometri Analitik, menarik untuk dibahas dalam tulisan ini.
Peningkatan Kualitas Perkuliahan Di Jurusan Matematika Fmipa Unnes Melalui Lesson Study Junaedi, Iwan
Kreano, Jurnal Matematika Kreatif-Inovatif Vol 1, No 2 (2010): Kreano, Jurnal Matematika Kreatif-Inovatif
Publisher : Jurusan Matematika, Fakultas Matematika dan Ilmu Pengetahuan Alam, Universitas Negeri Sema

Show Abstract | Download Original | Original Source | Check in Google Scholar | DOI: 10.15294/kreano.v1i2.1496

Abstract

Peningkatan kualitas perkuliahan di Jurusan Matematika FMIPA Unnes terus dilakukan. Salah satuupayanya adalah membangun forum sharing pengalaman di antara dosen dan mahasiswa melaluikegiatan Lesson Study. Penerapan Lesson Study antara lain berdampak pada: (1) teridentifikasinyapermasalahan belajar mahasiswa, (2) peningkatan kerja sama antar dosen dalam jurusan maupun diluar jurusan/fakultas, (3) terbentuknya kerja sama dosen dan guru di sekolah mitra, (4) peningkatanpelayanan perkuliahan, (5) diperolehnya pernagkat-perangkat perkulihan berbasis Lesson Study, (6)diperolehnya hasil-hasil penelitian dan karya ilmiah berbasis Lesson Study, dan (7) terdokumennyahasil-hasil dan pelaksanaan Lesson Study.Kata Kunci: Lesson Study, pembelajaran, permasalahan belajar
Pembelajaran Matematika Dengan Strategi Writing In Perfomance Tasks (Wipt) Untuk Meningkatkan Kemampuan Menulis Matematis junaedi, Iwan
Kreano, Jurnal Matematika Kreatif-Inovatif Vol 1, No 1 (2010): Kreano, Jurnal Matematika Kreatif-Inovatif
Publisher : Jurusan Matematika, Fakultas Matematika dan Ilmu Pengetahuan Alam, Universitas Negeri Sema

Show Abstract | Download Original | Original Source | Check in Google Scholar | DOI: 10.15294/kreano.v1i1.218

Abstract

The problem of this paper  is mathematical writing as a part of mathematical communication aspect that has not been developed optimally for the  students. One of a teaching process to develop the students’ability in mathematical writing is Writing in Performance Tasks (WiPT) strategy. The main purpose of this paper is to investigate whether a teaching process using WiPT strategy can increase  students’ability in mathematical writing. Key words: WiPT Strategy, mathematical writing, communication.
Keefektifan Model Pembelajaran Generatif dan MMP Terhadap Kemampuan Pemecahan Masalah Alba, F. Muttaqid; Chotim, Moch.; Junaedi, Iwan
Kreano, Jurnal Matematika Kreatif-Inovatif Vol 4, No 2 (2013): Kreano, Jurnal Matematika Kreatif-Inovatif
Publisher : Jurusan Matematika, Fakultas Matematika dan Ilmu Pengetahuan Alam, Universitas Negeri Sema

Show Abstract | Download Original | Original Source | Check in Google Scholar | DOI: 10.15294/kreano.v4i2.3136

Abstract

AbstrakPenelitian ini bertujuan untuk mengetahui keefektifan pembelajaran menggunakan model ge-neratif dan model Missouri Mathematics Project (MMP)terhadap kemampuan pemacahan masalah siswa kelas X materi jarak pada bangun ruang dan untuk mengetahui pembelajaran yang lebih efektif antara pembelajaran dengan model pembelajaran generatif dan pembela-jaran dengan model pembelajaran MMP terhadap kemampuan pemecahan masalah. Populasi dalam penelitian ini adalah siswa kelas X MAN 1 Kota Magelang tahun pelajaran 2012/2013 yang berada dalam sepuluh kelas. Uji ketuntasan belajar memberikan hasil yaitu sis-wa kelas eksperimen 1 dan 2 telah mencapai ketuntasan belajar. Uji proporsi memberikan ha-sil yakni kemampuan pemecahan masalah siswa kelas eksperimen 1 sama baiknya dibanding kemampuan pemecahan masalah siswa kelas eksperimen 2. Hasil Penelitian menunjukkan pembelajaran model generatif dan MMP efektif terhadap kemampuan pemecahan masalah pada materi jarak pada bangun ruang dan pembelajaran menggunakan model pembelajaran generatif sama efektifnya dengan pembelajaran menggunakan model pembelajaran MMP terhadap kemampuan pemecahan masalah. Kata Kunci: Generatif; Jarak pada Bangun Ruang; Kemampuan Pemecahan Masalah; MMP.  AbstractThe purpose of this study was to know whether learning with generative model and Missouri Mathematics Project (MMP) model effective against problem solving ability of grade X students of distance in solid shapes material and to know which one was better between generative learning model and MMP model. The population of this study was the students of grade X MA State 1 Magelang year 2012/2013 in 10 classes. From the result of the test was obtained that experiment class students achieved the learning completeness. From the proportion test results gotten the student problem solving ability of 1st experiment class was more same as than 2nd experiment class. The research result showed that the generative and MMP model effective against problem solving ability of distance in solid shapes material and generative learning model as same effective as MMP against problem solving. Keywords: Distance in Solid Shapes; Generative; MMP; Problem Solving Ability.
Penerapan Realistic Mathematics Education (RME) dengan Konteks Karakter dan Konservasi untuk Meningkatkan Kemampuan Mahasiswa dalam Menyusun Proposal Penelitian Junaedi, Iwan; Asikin, Muhammad; Masrukan, Masrukan
Kreano, Jurnal Matematika Kreatif-Inovatif Vol 6, No 2 (2015): Kreano, Jurnal Matematika Kreatif-Inovatif
Publisher : Jurusan Matematika, Fakultas Matematika dan Ilmu Pengetahuan Alam, Universitas Negeri Sema

Show Abstract | Download Original | Original Source | Check in Google Scholar | DOI: 10.15294/kreano.v6i2.4988

Abstract

Tujuan penelitian ini adalah mendeskripsikan peningkatan kemampuan mahasiswa dalam menyusun proposal penelitian pendidikan matematika dengan topik pengembangan karakter dan konservasi pada pembelajaran dengan pendekatan Realistic Mathematics Education (RME) dengan konteks konservasi dan karakter. Penelitian ini merupakan Penelitian Tidakan Kelas (PTK). Subjek penelitian adalah mahasiswa program studi pendidikan matematika yang mengambil mata kuliah Dasar-dasar Penelitian Pendidikan Matematika Tahun Akademik 2014/2015. Hasil penelitian diperoleh bahwa  (1) sekurang-kurangnya 72,22% pada siklus pertama, dan 83,33 % pada siklus kedua kinerja mahasiswa dalam menyusun proposal penelitian pendidikan matematika dengan topik karakter dengan kategori baik dan sangat baik, (2)  sekurang-kurangnya 33,33%  dan 72,22% pada siklus kedua kinerja mahasiswa dalam menyusun proposal penelitian pendidikan matematika dengan topik konservasi dengan kategori baik dan sangat baik, dan (3) kesulitan mahasiswa dalam menyusun proposal penelitian dengan topik konservasi antara lain terbatasnya literatur yang mengaitkan matematika dengan konservasi.The purpose of this study was to describe the increase in students ability to develop a mathematics education research proposal with character development and conservation topics on learning ap­proach Realistic Mathematics Education (RME) with a conservation context and character. This research is a Classroom Action Research (CAR). The subjects were students of mathematics edu­cation are taking courses Dasar-dasar Penelitian Pendidikan Matematika on Academic Year 2014/2015. The result showed that (1) at least 72.22% in the first cycle, and 83.33% in the second cycle the performance of students in mathematics education research proposal on the topic of character with good and excellent categories, (2) at least 33.33% and 72.22% in the second cycle the performance of students in mathematics education research proposal on the topic of conserva­tion with good and excellent categories, and (3) the difficulty of students to develop a research proposal to the topic of conservation, among others, the limited literature linking mathematics with conservation.
Analisis Deskriptif Soal Geometri dalam Buku Matematika Bilingual untuk Sekolah Menengah Pertama Kelas VIII Berdasarkan Kriteria International Assessment TIMSS 2007 Rahayu, Etik; Suyitno, Hardi; Junaedi, Iwan
Kreano, Jurnal Matematika Kreatif-Inovatif Vol 3, No 1 (2012): Kreano, Jurnal Matematika Kreatif-Inovatif
Publisher : Jurusan Matematika, Fakultas Matematika dan Ilmu Pengetahuan Alam, Universitas Negeri Sema

Show Abstract | Download Original | Original Source | Check in Google Scholar | DOI: 10.15294/kreano.v3i1.2608

Abstract

Tujuan penelitian ini adalah untuk mendeskripsikan  domain kognitif dan aspek kognitif (required behavior) soal matematika dalam Buku Matematika Bilingual untuk Sekolah Menengah Pertama (SMP) Kelas VIII berdasarkan kriteria International Assessment TIMSS 2007 dan proporsinya. Metode penelitian yang digunakan adalah deskriptif kualitatif, dengan subjek penelitian adalah soal geometri dalam Buku Matematika Bilingual SMP. yang berjudul “Mathematics for Junior High School Grade VIII 1st Semester” dan “Mathematics for Junior High School Grade VIII 2nd Semester” karangan karangan M. Cholik Adinawan dan Sugijono. Pengumpulan data menggunakan metode observasi dan wawancara tentang penggunaan buku matematika bilingual yang paling banyak digunakan di kota semarang. Pedoman analisis soal berdasarkan kriteria International Assessment TIMSS 2007, dengan validasi hasil oleh ahli. Hasil penelitian menunjukkan bahwa soal yang dianalisis memuat satu hingga tujuh aspek kognitif. Sebagian besar soal memuat 4 aspek kognitif yaitu 44.04 %, diikuti soal dengan 3 aspek kognitif  yaitu 36, 42%,  soal dengan 2 aspek kognitif yaitu 14, 90%, kemudian 1,99% untuk soal dengan 1 atau 5 aspek kognitif, dan 0,33% untuk soal dengan 6 atau 7 aspek kognitif. Proporsi tinggi pada recall (28.26%) dan compute (26.57%), diikuti dengan SRP (10.85%), implement (10.65%), retrieve (8.36%), recognize (6.17%), analyze (1.99%), measure (1.59%), generalize (1.09%), SNRP (1.00%), classify (0.80%), represent (0.80%), justify (0.80%), select (0.60%), model (0.30%), synthesis (0.20%). Secara keseluruhan berdasarkan International Assessment TIMSS 2007 soal yang termasuk domain knowing memiliki persentase paling tinggi (52.28%), domain knowing-applying (24.83%), domain knowing- reasoning (12.91%), dan hanya sedikit yang termasuk domain knowing-apllying-reasoning (3.97%). Serta terdapat 4 soal (1.32%) yang mempunyai ketidaksesuaian penggunaan mathematics terms serta 1 soal (0.33%) mempunyai kesalahan penyajian dalam  soal versi bahasa Inggris. Hasil penelitian menunjukan bahwa aspek kognitif (required behavior) yang termasuk dalam domain reasoning sangat sedikit dibandingkan dengan aspek kognitif (required behavior) pada domain knowing dan applying yakni 5.07%.
PENGEMBANGAN MODEL PELATIHAN INNOMATTS UNTUK MENINGKATKAN KOMPETENSI DAN KARAKTER GURU MATEMATIKA Asikin, Mohammad; Junaedi, Iwan; Cahyono, Adi Nur
Jurnal Penelitian Pendidikan Vol 32, No 2 (2015)
Publisher : Universitas Negeri Semarang

Show Abstract | Download Original | Original Source | Check in Google Scholar | DOI: 10.15294/jpp.v32i2.5713

Abstract

This research is a development research which aims to develop a training model which is able to improve mathematics teachers’ competence and character. This research was implemented into two year phase. The first year focused on the exploration study and the model validation. This phase successfully identified the need of the mathematics teachers and generated a valid training model called the Innovative Mathematics Teaching Study (INNOMATTS). The second year focused on the implementation and dissemination of the model. This article aims to describe the practicality and the effectiveness of INNOMATTS training model in improving mathematics teachers’ competence and character as it was developed based on the mathematics teachers’ need, containing mathematics learning innovation and having orientation toward character education. The research follows the Research and Development (R & D) of Gall. The evaluation of the model implementation quality used three criteria: validity, practicality, and effectiveness. The result suggests that the INNOMATTS training model is practical based on the percentage response of the planning, implementation and evaluation. The model is also effective based on the evaluation of lesson plan produced during the training, the learning implemented, and the result of teacher’s competence test.
Keefektifan Model Pembelajaran Generatif dan MMP Terhadap Kemampuan Pemecahan Masalah Alba, F. Muttaqid; Chotim, Moch.; Junaedi, Iwan
Kreano, Jurnal Matematika Kreatif-Inovatif Vol 4, No 2 (2013): Kreano, Jurnal Matematika Kreatif-Inovatif
Publisher : Jurusan Matematika, Fakultas Matematika dan Ilmu Pengetahuan Alam, Universitas Negeri Sema

Show Abstract | Download Original | Original Source | Check in Google Scholar | DOI: 10.15294/kreano.v4i2.3136

Abstract

AbstrakPenelitian ini bertujuan untuk mengetahui keefektifan pembelajaran menggunakan model ge-neratif dan model Missouri Mathematics Project (MMP)terhadap kemampuan pemacahan masalah siswa kelas X materi jarak pada bangun ruang dan untuk mengetahui pembelajaran yang lebih efektif antara pembelajaran dengan model pembelajaran generatif dan pembela-jaran dengan model pembelajaran MMP terhadap kemampuan pemecahan masalah. Populasi dalam penelitian ini adalah siswa kelas X MAN 1 Kota Magelang tahun pelajaran 2012/2013 yang berada dalam sepuluh kelas. Uji ketuntasan belajar memberikan hasil yaitu sis-wa kelas eksperimen 1 dan 2 telah mencapai ketuntasan belajar. Uji proporsi memberikan ha-sil yakni kemampuan pemecahan masalah siswa kelas eksperimen 1 sama baiknya dibanding kemampuan pemecahan masalah siswa kelas eksperimen 2. Hasil Penelitian menunjukkan pembelajaran model generatif dan MMP efektif terhadap kemampuan pemecahan masalah pada materi jarak pada bangun ruang dan pembelajaran menggunakan model pembelajaran generatif sama efektifnya dengan pembelajaran menggunakan model pembelajaran MMP terhadap kemampuan pemecahan masalah. Kata Kunci: Generatif; Jarak pada Bangun Ruang; Kemampuan Pemecahan Masalah; MMP.  AbstractThe purpose of this study was to know whether learning with generative model and Missouri Mathematics Project (MMP) model effective against problem solving ability of grade X students of distance in solid shapes material and to know which one was better between generative learning model and MMP model. The population of this study was the students of grade X MA State 1 Magelang year 2012/2013 in 10 classes. From the result of the test was obtained that experiment class students achieved the learning completeness. From the proportion test results gotten the student problem solving ability of 1st experiment class was more same as than 2nd experiment class. The research result showed that the generative and MMP model effective against problem solving ability of distance in solid shapes material and generative learning model as same effective as MMP against problem solving. Keywords: Distance in Solid Shapes; Generative; MMP; Problem Solving Ability.
Peningkatan Kualitas Perkuliahan Di Jurusan Matematika Fmipa Unnes Melalui Lesson Study Junaedi, Iwan
Kreano, Jurnal Matematika Kreatif-Inovatif Vol 1, No 2 (2010): Kreano, Jurnal Matematika Kreatif-Inovatif
Publisher : Jurusan Matematika, Fakultas Matematika dan Ilmu Pengetahuan Alam, Universitas Negeri Sema

Show Abstract | Download Original | Original Source | Check in Google Scholar | DOI: 10.15294/kreano.v1i2.1496

Abstract

Peningkatan kualitas perkuliahan di Jurusan Matematika FMIPA Unnes terus dilakukan. Salah satuupayanya adalah membangun forum sharing pengalaman di antara dosen dan mahasiswa melaluikegiatan Lesson Study. Penerapan Lesson Study antara lain berdampak pada: (1) teridentifikasinyapermasalahan belajar mahasiswa, (2) peningkatan kerja sama antar dosen dalam jurusan maupun diluar jurusan/fakultas, (3) terbentuknya kerja sama dosen dan guru di sekolah mitra, (4) peningkatanpelayanan perkuliahan, (5) diperolehnya pernagkat-perangkat perkulihan berbasis Lesson Study, (6)diperolehnya hasil-hasil penelitian dan karya ilmiah berbasis Lesson Study, dan (7) terdokumennyahasil-hasil dan pelaksanaan Lesson Study.Kata Kunci: Lesson Study, pembelajaran, permasalahan belajar